#EXP00207

General

Accession EXP00207
Activity Preformed biofilm
Date 2014-02-21
Administration In solution
Model in vitro
Organism Cryptococcus neoformans B3501
Status Validated
Notes No notes

Peptide

beta-Defensin 3

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Experimental activity

Method Concentration Notes
XTT assay 2 uM No notes
XTT assay 4 uM No notes
XTT assay 8 uM No notes
Total countable CFUs 2 uM No notes
Total countable CFUs 4 uM No notes
Total countable CFUs 8 uM No notes

References

Cryptococcus neoformans Cells in Biofilms Are Less Susceptible than Planktonic Cells to Antimicrobial Molecules Produced by the Innate Immune System

L. R. Martinez, A. Casadevall

2006. Infection and Immunity 11:6118-6123